PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_39849
Common NameKK1_037444
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family BBR-BPC
Protein Properties Length: 280aa    MW: 31183.9 Da    PI: 10.3666
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_39849genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind352.11.2e-10712801301
      GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllall 85 
                    md d+  + rn+gyyepa  +k++lglqlmss++e+     r++ + ls++++a+++rd         m++ +rd+++++       +++k+++++
  C.cajan_39849   1 MDGDNGLNiRNWGYYEPA--IKSHLGLQLMSSMPEKPLIGgRNAAV-LSGTNGAFHHRDigmhqatypMEY-MRDAWISS-------QRDKYMNMI 85 
                    888888888********9..**************988766355555.9***********************.9*****99.......889****** PP

      GAGA_bind  86 lvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkke 181
                    +++++        ++ +++t+s++++q+     ++ + ++      +e++p+eea+ ++k + ++kkrq +k+pk++kakk+k+ ++++k+++ ++
  C.cajan_39849  86 PTNHN--------YGGIPETSSAHQIQM-----IQAPEMP------KEEKPVEEAPVVEKPNGTRKKRQGPKVPKSPKAKKPKRGPRTPKDEN-TP 161
                    *9997........999************.....3322222......345788999999999999999*****************777775555.55 PP

      GAGA_bind 182 saderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGy 277
                    s+ +r++a+kk++++v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt +S+yPLP+stkrrgaRiagrKmS gafkk+LekLaaeGy
  C.cajan_39849 162 SV-QRARAPKKTTEIVINGIDMDISSIPIPVCSCTGTPQQCYRWGSGGWQSACCTTGMSIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGY 256
                    54.79******************************************************************************************* PP

      GAGA_bind 278 dlsnpvDLkdhWAkHGtnkfvtir 301
                    ++snp+DL+++WAkHGtnkfvtir
  C.cajan_39849 257 NFSNPIDLRTYWAKHGTNKFVTIR 280
                    ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.1E-1701280IPR010409GAGA-binding transcriptional activator
PfamPF062171.2E-1141280IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDGDNGLNIR NWGYYEPAIK SHLGLQLMSS MPEKPLIGGR NAAVLSGTNG AFHHRDIGMH  60
QATYPMEYMR DAWISSQRDK YMNMIPTNHN YGGIPETSSA HQIQMIQAPE MPKEEKPVEE  120
APVVEKPNGT RKKRQGPKVP KSPKAKKPKR GPRTPKDENT PSVQRARAPK KTTEIVINGI  180
DMDISSIPIP VCSCTGTPQQ CYRWGSGGWQ SACCTTGMSI YPLPMSTKRR GARIAGRKMS  240
IGAFKKVLEK LAAEGYNFSN PIDLRTYWAK HGTNKFVTIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5024310.0AF502431.1 Glycine max GAGA-binding protein (gbp) mRNA, complete cds.
GenBankBT0933840.0BT093384.1 Soybean clone JCVI-FLGm-17A2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534122.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_003534123.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD01e-94BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A151REV50.0A0A151REV5_CAJCA; Uncharacterized protein
STRINGGLYMA09G30040.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.36e-89basic pentacysteine 2